- Recombinant Mouse Small proline-rich protein 2I (Sprr2i)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1173007
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 8,356 Da
- E Coli or Yeast
- 27760
- small proline-rich protein 2I
- Small proline-rich protein 2I (Sprr2i)
Sequence
MSYQQQQCKQPCQPPPVCPPKKCPEPCPPPQCPEPCPPPKCPEPCPESCPPPSYQQKCPPVQPPPPCQQKCPPKSK